Rat Secondary Antibodies
CPC Scientific H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt) 0.5MG
SEQUENCE: H-Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH (trifluoroacetate salt)(Cys20 and 40, Cys14 and 32, Cys34 and 47)ONE-LETTER SEQUENCE: IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Cys20 and 40 bridge, Cys14 and 32 bridge, Cys34 and 47 bridge)MOLECULAR FORMULA: C226H367N65O65S7MOLECULAR WEIGHT: 5259.34STORAGE CONDITIONS: -20 5 CCAS REGISTRY NUMBER: [209615-79-2]SYNONYMS: CART (55-102) (rat)RESEARCH AREA: ObesityREFERENCES:SKU(s): CART-002A, CART-002B
ABclonal Technology PE/Cyanine7 anti-h CD90/Thy1
This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins The encoded protein is involved in cell adhesion and cell communication in numerous cell types but particularly in cells of the immune and nervous systems The encoded protein is widely used as a marker for hematopoietic stem cells This gene may function as a tumor suppressor in nasopharyngeal carcinoma Alternative splicing results in multiple transcript variants
Medchemexpress LLC Recombinant mouse Thy1 (CD90) protein, C-terminal His tag | >95.0% | 1 MG
Thy1/CD90 recombinant mouse extracellular domain produced in HEK293 cells with a C-terminal His tag. Supplied lyophilized from PBS, this protein is provided at high purity for use in binding assays and functional studies; apparent molecular weight varies with glycosylation. Store frozen and avoid repeated freeze-thaw cycles.
- Recombinant extracellular domain produced in mammalian cells for native glycosylation
- High purity suitable for biochemical and immunoassays
- C-terminal His tag for affinity purification and detection
- Lyophilized formulation for long-term storage and ease of handling
- Validated in ELISA binding assays for ligand interaction studies
- Store frozen and aliquot to prevent freeze-thaw
Medchemexpress LLC EGFR Rat HEK293 H 1mg
EGFR Protein is a receptor tyrosine kinase that binds to ligands of the EGF family EGFR Protein is involved in the regulation of NF-kappa-B RAS-RAF-MEK-ERK PI3 kinase-AKT PLCgamma-PKC and STATs signaling pathways EGFR Protein has calmodulin binding activity epidermal growth factor binding activity and epidermal growth factor activating receptor activity EGFR Protein Rat (HEK293 His) is the recombinant rat-derived EGFR protein expressed by HEK293 with C-His labeled tag
INTACT GENOMICS INC ig Stable 2 Electrocompetent E. coli Cells 12x50μl
Intact Genomics (ig) Stable 2 Electrocompetent E. coli cells offer the highest transformation efficiencies of ≥2 x 10^10 cfu/µg plasmid DNA which are ideal for applications requiring high transformation efficiencies, such as cDNA or gDNA library construction. Stable 2 cells are capable of cloning methylated genomic sequences, retroviral sequences and direct repeat sequences. Intact Genomics Stable 2 cells provide superb transformation efficiency, allowing for increased opportunity for experimental success.ig Stable 2 Electrocompetent Cells have the following features: Stable 2 allows for cloning of methylated genomic sequences Stabilizes retroviral and direct repeat sequences including HIV High transformation efficiency allows aids in cloning rare sequences May be used for plasmids > 20 kb endA1 mutation increases plasmid yield significantlyIncludes and Storage: ig Stable 2 Electrocompetent Cells: -80 ºCpUC19 control DNA: -20 ºCRecovery medium: 4 ºC
ABclonal Technology APC/Cy7 anti-h/Mk CD19
This gene encodes a cell surface protein in the immunoglobulin superfamily expressed exclusively on B cell lymphocytes It serves as a marker for pre-B cells with expression decreasing as B cells differentiate into antibody-secreting plasma cells The protein contains two N-terminal Ig-like domains a non-Ig-like domain a transmembrane region and a large cytoplasmic domain It forms a complex with CD21 and CD81 lowering the threshold for antigen-triggered B cell activation which activates the PI3K signaling pathway and calcium release This protein is targeted by CAR T-cells for treating lymphoblastic leukemia Mutations are linked to common variable immunodeficiency 3 (CVID3) causing impaired B-cell differentiation hypogammaglobulinemia inability to respond to antigens and recurrent infections Alternative splicing produces multiple transcript variants encoding distinct isoforms
ABclonal Technology PE Rabbit anti- CD162/PSGL-1
Involved in leukocyte adhesive activation Acts upstream of or within leukocyte tethering or rolling Predicted to be located in plasma membrane raft and uropod Predicted to be active in plasma membrane Is expressed in brain and thymus primordium Human ortholog(s) of this gene implicated in carotid artery disease Orthologous to human SELPLG (selectin P ligand)
ABclonal Technology APC/Cy7 anti-h/Mk CD8a
The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system The CD8 antigen acts as a coreceptor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell in the context of class I MHC molecules The coreceptor functions as either a homodimer composed of two alpha chains or as a heterodimer composed of one alpha and one beta chain Both alpha and beta chains share significant homology to immunoglobulin variable light chains This gene encodes the CD8 alpha chain Multiple transcript variants encoding different isoforms have been found for this gene The major protein isoforms of this gene differ by the presence or absence of a transmembrane domain and thus differ in being a membrane-anchored or secreted protein
Cytek Biosciences Inc PE-Cy7 Mu IgG1 Iso Con Anti Is
Product Name: PE-Cyanine7 Mouse IgG1 Isotype Control (MOPC-21)
Product Class: Antibody
Type: Isotype Control
Product Name: PE-Cyanine7 Mouse IgG1 Isotype Control (MOPC-21)
Cytek Catalog Number: 60-4714-U100
Marker: Isotype Control
Clonality: Monoclonal
Clone: MOPC-21
Host Species: Mouse
Isotype: IgG1
Conjugation: PE-Cyanine7
Size: 100 μg
INTACT GENOMICS INC ig 5-alpha Electrocompetent Cells 12x100µl
Intact Genomics 5 alpha Electrocompetent E. coli cells are suitable for high efficiency transformation in a wide variety of routine applications such as plasmid isolation, cloning, and subcloning. Mutations in endA1 and recA1 ensure increased plasmid yield and improved plasmid quality.ig 5-alpha Electrocompetent Cells have the following features: ≥2 x 10^10cfu/µg efficiency with electroporation Greatly increased plasmid yield and quality due to endA1 mutation High-efficiency transformation with plasmids 30 kb in size Blue/white screening of recombinant clones due to lacZΔM15 Ensured insert stability due to recA1 mutationProduct Includes and Storage:ig™ 5 alpha Electrocompetent Cells: -80 ºCpUC19 control DNA: -20 ºCRecovery medium: 4 ºC